General Information

  • ID:  hor002467
  • Uniprot ID:  NA
  • Protein name:  histidine-rich basic peptide
  • Gene name:  NA
  • Organism:  Aplysia californica
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  EVAQMHVWRAVNHDRNHGTGSGRHGRFLIRNRYRYGGGHLSDA
  • Length:  43
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excites Aplysia heart and enhances gut motility
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002467_AF2.pdbhor002467_ESM.pdb

Physical Information

Mass: 569177 Formula: C211H323N79O59S
Absent amino acids: CKP Common amino acids: GR
pI: 11.74 Basic residues: 12
Polar residues: 15 Hydrophobic residues: 11
Hydrophobicity: -106.51 Boman Index: -14055
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 54.42
Instability Index: 1910.7 Extinction Coefficient cystines: 8480
Absorbance 280nm: 201.9

Literature

  • PubMed ID:  2573895
  • Title:  Aplysia Californica Neurons R3-R14: Primary Structure of the Myoactive Histidine-Rich Basic Peptide and Peptide I